Was Vitamin D zu nehmen: Vigantol, Akvadetrim und andere


Sehr oft fragen sie, ob es möglich ist, Vitamin-D-Präparate wie Vigantol, Akvadetrim, Alpha D3 Teva, Ultra D einzunehmen. Versuchen wir das zu klären. In diesem Artikel betrachten wir eine prophylaktische Dosis von Vitamin D3 - 10.000 IE.

Was ist Vigantol und wer kann es nehmen?

Vigantol ist ein Vitamin-D-Präparat, das genau so ist wie das Vitamin-D-Cholecalceferol-Präparat Akvadetrim. Was ist der Unterschied zwischen Viganthol und Akkadetrim? Der Unterschied bei Ballaststoffen.

Was ist in Vigantole?

In Viganthol sind Triglyceride eine Hilfssubstanz, d. H. Dies ist eine ölige fettige Lösung von Vitamin D. Vigantol und Akvadetrim sind Tropfen für Kinder. Die Dosis wurde für 1-2 Tropfen bestimmt. Wenn wir die Dosis erhöhen, kann dies zu Problemen führen, denn durch die richtige Dosierung von Vitamin D erhalten wir eine Überdosis Ballaststoff, eine Überdosis Triglyceridfette. Fette werden ohne Gallensäuren nicht aufgenommen. Wenn eine Person Probleme mit der Produktion von Gallensäuren hat, Cholelithiasis, verschlimmern Sie sie nur mit Vigantol in einer Dosierung von mehr als 10 Tropfen. Und wenn eine Person keine Gallenblase hat (entfernt oder deaktiviert) - was bekommen Sie? Sie erhalten eine Verletzung der Resorption und Verdauung des Stoffwechsels Vigantola, Stuhlerkrankung. Vigantol wird in der Galle ausgeschieden. Wenn keine Gallenblase vorhanden ist oder sie nicht richtig funktioniert oder die Produktion von Gallensäuren bei Kindern nicht gestört wird, ist die Einnahme von Vigantol nicht möglich. Dieses Medikament kann nur von Personen eingenommen werden, die keine Probleme mit der Gallenblase und der Produktion von Gallensäuren (in einer Dosis von nicht mehr als 10.000 IE) haben.

Akvadetrim - an wen? Was sind die sonstigen Bestandteile in Akvadetrim?

In Akvadetrim sind Hilfsstoffe Saccharose, Zitronensäure, Alkohol usw.

Dieses Medikament hat viele Hilfsstoffe, die allergisch sein können.

Saccharose kann die Manifestation eines übermäßigen Bakterienwachstums verschlimmern. Wenn also gute anabole Wirkungen erzielt werden, das Haarwachstum verbessert wird, die körperliche und kognitive Aktivität verbessert werden, usw., werden sich die Probleme der Darmdysbiose verschlechtern. Darüber hinaus enthält die Zusammensetzung von Akvadetrima Benzylalkohol. Wie gefährlich es ist, lesen Sie im Artikel Gesundheit unserer Kinder.

Ob Vigantol oder Akvadetrim Kinder geben?

Bei Kindern ist die Arbeit der Gallenblase noch nicht etabliert, daher sollte Kindern keine Vigantol gegeben werden. Kinderärzte ernennen Kinder Akvadetrim. Aber wieder, wenn das Kind keine Probleme mit dem Syndrom des übermäßigen Bakterienwachstums hat. Heute haben diese Probleme viele Kinder. Wenn solche Probleme auftreten, sollten Kindern über 3 Jahre Kautabletten gegeben werden, die in den Mund aufgenommen werden und den Darm umgehen. Lesen Sie immer die Anweisungen, bevor Sie das Medikament einnehmen.

Vigantol oder Akvadetrim mit Nierenschaden und ICD?

Wenn Sie Probleme mit der Gallenblase haben, sollten Sie keine Lösung mit Vigantola geben. Und wenn es Probleme mit der Niere oder dem ICD gibt (dies sind Probleme der Nieren) - es ist unmöglich, Akvadetrim zu verabreichen. Warum Wegen verschiedener Stoffwechselwege: Vigantol wird mit Gallensäuren metabolisiert und ausgeschieden und Akvadetrim wird in der Leber und in den Nieren metabolisiert. Wenn die Arbeit der Nieren beeinträchtigt ist, wird der Stoffwechsel verletzt.

Akvadetrim - Kontraindikationen: Überempfindlichkeit gegen das Medikament. Es gibt viele verschiedene Bestandteile der Droge, insbesondere Alkohol. Es wird nicht empfohlen, Diuretika einzunehmen, da dies die Nieren belastet.

Ultra Ultra D (1000 IE in einer Tablette)

Sehen Sie, wie viele Ballaststoffe oder Hilfsstoffe enthalten sind. Wenn Sie also eine große Dosis benötigen, um die Anzahl der Tabletten zu erhöhen, erhöhen Sie die Anzahl der Ballaststoffe. Diese heute bestehenden Allergien (und wir hören oft, dass Vitamin D allergisch ist) sind das Ergebnis der Einnahme einer großen Menge von Hilfsstoffen. Vitamin D kann nicht allergisch sein. Vitamin D ist selbst ein antiallergisches Hormon (es ist ein Hormon, das für das Immunsystem selbst und durch eine Erhöhung der Progesteronsynthese verantwortlich ist). Vitamin D-Allergie ist eine Allergie gegen Ballaststoffe.

Alpha D3 Teva (0,25-1mkg in 1 Kapseln)

Der Hauptbestandteil des Medikaments Alpha D3 der Firma Teva ist Alfacalcidol (1-Hydroxycholecalciferol).

Alfacalcidol ist ein synthetisches Analogon von Vitamin D3.

Dieses Medikament ist ein aktiver Metabolit und wird nur bei Patienten mit chronischer Nieren- und Leberinsuffizienz verwendet.

In der normalen Praxis können aktive Metaboliten nicht dazu verwendet werden, Vitamin D auszugleichen.

Wenn Sie ein hochwertiges Vitamin D3-Präparat erhalten möchten, achten Sie auf Nahrungsergänzungsmittel. In der Russischen Föderation sind sie noch nicht zertifiziert, aber Sie können bei ausländischen Online-Shops bestellen. Viele Ärzte empfehlen Vitamin D3 aus Healthy Origins, das neben dem Vitamin D-Präparat selbst nur Olivenöl enthält, das für die Aufnahme des Vitamins notwendig ist Es ist fettlöslich.

Was füllt Vitamin D-Mangel besser: Vigantol oder Akvadetrim?

Die Komposition scheint gleich zu sein, aber wie sieht es mit den Effekten aus?

Die Menge an Vitamin D in einem Tropfen Akvadetrima (wässrige Lösung) und 1 Tropfen Vimantol (Öllösung) ist gleich. Daher können wir darüber sprechen, wie Vitamin D von diesen Medikamenten aufgenommen wird.

Der Arzt hat uns akvadetrim verordnet, wir akzeptieren es.

Der Arzt erklärte die Wahl damit, dass Akvadetrim eine wässrige Lösung ist und daher vom Körper besser aufgenommen wird, insbesondere wenn es sich um Babys handelt. Vielmehr ist er zur Assimilation bereit, der Körper braucht keine zusätzliche Arbeit. Schließlich ist der Magen-Darm-Trakt von Babys noch nicht entwickelt, möglicherweise sind nicht die notwendigen Enzyme für die Assimilation der Öllösung vorhanden.

Die Öllösung kann jedoch schlechter oder überhaupt nicht absorbiert werden, insbesondere wenn eine Person Probleme mit der Leber, mit dem Fluss der Galle oder mit der Synthese von Gallensäuren usw. hat.

Die Wahl zwischen den Medikamenten "Vigantol" oder "Akvadetrim" hängt manchmal nur davon ab, welche von ihnen für einen bestimmten Organismus besser geeignet ist. Aufgrund der synthetischen Komponenten kann "Aquadetrim" der Auslöser einer allergischen Reaktion sein. In diesem Fall können Sie es schmerzlos durch "Vigantol" ersetzen. Es muss jedoch bedacht werden, dass es keine Omega-3-Säuren und Vitamin A enthält. "Vigantol" wird in der Apotheke seltener gesehen. Mein Freund wurde genau "Vigantol" geschrieben. Ärzte verschreiben auch seine Kinder, auch Frühgeborene. Beim Auffüllen von Vitamin "D" sind beide Arzneimittel gleichermaßen wirksam, wenn Sie die Merkmale eines bestimmten Organismus nicht berücksichtigen.

Ich glaube, ich hatte in gewissem Sinne Glück mit dem Körper: Er absorbiert gleichermaßen "Vigantol" und "Akvadetrim". Gleichzeitig mag ich "Vigantol" persönlich, und die Gründe dafür sind besonders praktisch: Der Gehalt an Vitamin D in einem Glas "Vigantola" ist mehr als im gleichen Volumen von "Akvadetrim". Ich kaufe "Vigantol" in Reserve, gut, und dementsprechend ist es bequemer, weniger Dosen zu nehmen. Dann kann Öl „Vigantol“ leichter in einen Löffel getropft werden als flüssiges „Aquadetrim“: Der erste Tropfen tropft langsam, sodass Sie die Menge an Vitamin D genau berechnen können, der zweite Tropfen schnell und Sie können die Tropfen nicht immer richtig berechnen. Das ist umständlich. In der Komposition beider habe ich mich nicht sonderlich beschäftigt. Ich mag "Akvadetrim" mehr nach meinem Geschmack, aber ich akzeptiere leicht den Geschmack von "Vigantola". Da es in jeder Hinsicht bequemer ist, wähle ich es. Vitamin D wächst sowohl bei der ersten als auch bei der zweiten Droge gleich gut mit mir zusammen.

Vigantol vs Akvadetrim: Welches ist besser zu wählen?

Vitamin-D-Mangel im Körper des Kindes stört die Aufnahme von Kalzium und Phosphor im Darm. Dies führt häufig zu Problemen, insbesondere bei Babys. Bei Babys wachsen die Knochen sehr schnell, und ein unzureichender Mineralstoffwechsel kann sich zu einer Krankheit entwickeln, deren Folgen um das Leben kämpfen müssen.

Zur Vorbeugung von Rachitis und anderen Komplikationen, die mit einer abnormen Entwicklung des Skeletts einhergehen, werden Pädiatriepatienten für prophylaktische Zwecke praktisch allen Neugeborenen Medikamente mit Cholecalciferol (Vitamin D) verschrieben3) - normalerweise ist es Vigantol oder Akvadetrim.

Manchmal haben Ärzte das Recht, die Eltern zu wählen: "oder - kaufen Sie..."

Was ist die bevorzugte Medizin? Sind sie anders und wenn ja, durch was? Vigantol oder Akvadetrim - was ist das Beste für das Kind?

Auf unserer Website gibt es einige ausführliche Artikel mit Rezensionen:

Vielleicht werden sie dir nützlich sein. Wir beginnen mit einer vergleichenden Analyse von Drogen.

Was ist besser für Kinder - Vigantol oder Akvadetrim?

Vergleichen Sie mit Parametern

Ein Vergleich der Parameter von Vigantola und Akvadetrim hilft den Eltern zu entscheiden, welches dieser Medikamente für ihr Baby besser geeignet ist.

Zusammensetzung und Freisetzungsformen

Der Wirkstoff beider Medikamente ist Cholecalciferol. Die Wirkung von Medikamenten ist daher nahezu gleich. In Viganthole ist die Vitaminkonzentration höher, was das Risiko einer Überdosierung erhöht. Seien Sie besonders vorsichtig bei der Berechnung der Dosis.

Ähnliche Formen der Freisetzung von Medikamenten - Tropfen.

Die Anwesenheit von Alkohol: Ist das gefährlich?

Vigantol enthält keinen Alkohol, während diese Komponente in der Zusammensetzung von Aquadetrim enthalten ist, was viele Mütter beunruhigt. Eltern haben oft Angst, dem Kind Alkohol zu geben. Die Konzentration der Zutat in den Tropfen ist jedoch gering und die für Babys empfohlenen Dosierungen sind so gering, dass eine negative Auswirkung auf den Körper der Kinder ausgeschlossen wird.

Aquadime enthält Alkohol.

Sind zusätzliche Bestandteile potentielle Allergene?

Es gibt auch Zitronensäure, Saccharose, Anisaroma und andere Hilfsstoffe in der Zusammensetzung von Aquadetrim. Eine vollständige Liste finden Sie in der Anleitung - Laden Sie die Gebrauchsanweisung im PDF-Format herunter.

Bei Vigantola können Sie unter den zusätzlichen Komponenten - nur Triglyceride (Fette) - Anweisungen herunterladen.

In dieser Hinsicht, Kinder anfällig für Allergien, ist es besser, Vigantol zu kaufen. Die minimale Anzahl von Komponenten verringert das Risiko einer negativen Reaktion.

Während der Einnahme von Vigantol ist es jedoch immer noch notwendig, den Zustand des Kindes zu überwachen. In den Anweisungen für das Medikament sind Nebenwirkungen, die auf Cholecalciferol allergisch sind.

Vitamin D ist das allergeneste aller Vitamine.

Schmecken und riechen

Akvadetrim hat aufgrund der Anwesenheit einer Anzahl synthetischer Komponenten in der Zusammensetzung einen scharfen Geruch und einen nicht sehr angenehmen Geschmack. Daher weigern sich Kinder manchmal, "duftende" Medikamente einzunehmen. Tropfen müssen in Saft oder Muttermilch aufgelöst werden.

Vigantol ist ein Medikament ohne Geschmack und Geruch und kann als wichtiger Vorteil bezeichnet werden.

Eigenschaften des Grundöls - Wasser fürs Wasser?

Akvadetrim - eine Wasserlösung von Vitamin D3, Vigantol - Öl. Was ist die bevorzugte Option? Es wird angenommen, dass die wässrige Lösung "leichter" ist. Es wird schnell resorbiert (die Konzentration des Arzneimittels im Blut wächst etwa sechsmal schneller als bei der Einnahme eines Ölanalogons) und ist auch für Kinder mit unzureichender Gallebildung angezeigt.

Ölig - langsamer aufgenommen. Außerdem eignet es sich nicht für Babys mit einer erkrankten Leber - bei einer geringen Menge an Galle wird das Arzneimittel fast nicht aufgenommen. Öl erhöht jedoch die Bioverfügbarkeit von Vitamin D - der Verlust einer Substanz, wenn sie vom Körper verwendet wird, ist minimal.

Wässrige Lösung von Vitamin D3 wird besser aus dem Darm aufgenommen.

Indikationen und Kontraindikationen

Die Indikationen beider Medikamente sind identisch: die Vorbeugung und Behandlung von Rachitis und Rachitis-ähnlichen Erkrankungen. Kontraindikationen stimmen meist auch überein:

  • Hypervitaminose D;
  • erhöhte Konzentration von Ca (Kalzium) im Urin;
  • erhöhter Ca-Gehalt im Blut;
  • aktive Lungentuberkulose;
  • Leber- und Nierenerkrankung;
  • Sarkoidose (eine ungewöhnliche systemische Pathologie) und einige andere.

Vigantola hat jedoch mehr Kontraindikationen. Hinzu kommen Erkrankungen des Gastrointestinaltraktes, Hypothyreose, organische Herzkrankheiten, Herzversagen.

Alter der Patienten

Vigantol kann ab dem 14. Lebenstag Neugeborenen und Akvadetrim ab 4 Wochen verabreicht werden.

Nebenwirkungen

In Bezug auf Nebenwirkungen sind dann bei beiden Arzneimitteln üblich:

  • Allergie (das Risiko einer Allergie durch die Einnahme von Aquadetrim ist höher);
  • Verstopfung;
  • Hypervitaminose D;
  • Kopfschmerzen;
  • Beschwerden im Magen und einigen anderen.

Verstopfung ist eine Nebenwirkung der Medikation.

Spezifisch für Vigantola-Nebenwirkungen sind in der Anleitung aufgeführt - Nierenversagen, Anorexie, Arrhythmie, erhöhter Blutdruck.

Die Zeit der therapeutischen Wirkung

Die Dauer der therapeutischen Wirkung von Medikamenten variiert. In Vigantol sind dies 1,5 Monate, in Aquadetrim 3 Monate.

Empfangsfunktionen

Zur Prophylaxe sollten beide Medikamente einmal in 1-2 Tropfen eingenommen werden. Die therapeutische Dosis von Vigantol ist etwas niedriger als die von Akvadetrim. Dies ist auf die unterschiedliche Konzentration des Wirkstoffs in den Zubereitungen zurückzuführen (in Vigantola sind es mehr).

Wenn empfohlen wird, Akvadetrim vor dem Empfang ein wenig zu erwärmen (in den Handflächen), kann Vigantol ohne vorherige Vorbereitung verabreicht werden.

Dispenser-Design

Eltern in ihren Bewertungen schreiben, dass es nicht sehr bequem ist, die richtige Menge an Akvadetrim zu messen - dies liegt an den Eigenschaften des Spenders. Vigantola Dosierdüse dachte laut Mütter besser.

Beide Medikamente gehören zu derselben Preiskategorie. Die durchschnittlichen Kosten für Flaschen mit einer Kapazität von 10 ml - 200 Rubel.

Vigantol und Akvadetrim: Stellungnahme von Dr. Komarovsky

Komarovsky zufolge benötigt ein gesundes, langzeitiges Baby überhaupt keine prophylaktische Zufuhr von Vitamin D. Eine Ausnahme bilden Kinder, die in den nördlichen Gebieten mit einem kurzen hellen Tag leben. In anderen Fällen garantieren Muttermilch und tägliche Spaziergänge auf natürliche Weise eine ausreichende Produktion von Colecalciferol. Wenn die ernährungsphysiologischen Eigenschaften der Muttermilch im Zweifel sind, empfiehlt Komarovsky, auf die Anpassung der Ernährung zu achten, anstatt in der Apotheke einen „Top-Dressing“ für Säuglinge zu wählen.

Nach Ansicht von Komarovsky brauchen solche Kinder auch weder Vigantole noch Aquadetrim.

Wir sprechen hier über die Einnahme von Medikamenten zur Prophylaxe. Die allgemeine Verschreibung von Drogen zur Verhinderung von Rachitis hält Komarovsky für unangemessen. Ein Vitamin-D-Überschuss ist nicht weniger gefährlich als ein Mangel. Wenn jedoch eine Krankheit diagnostiziert wird - Rachitis, Osteomalazie, Osteopathie -, kann auf pharmazeutische Hilfe nicht verzichtet werden.

Für die Vorbeugung gegen Rachitis sind regelmäßige Spaziergänge mit einem Kind an der frischen Luft und ein Sonnenbad wichtig.

Bei der Wahl (Akvadetrim oder Vigantol) gibt Komarovsky aufgrund der Ähnlichkeit der Drogen keinen von ihnen eine ausgesprochene Präferenz. Eine gute Droge ist die richtige für Ihr Kind. Ist das Kind anfällig für Allergien? Hat er eine gastrointestinale Erkrankung? Produziert die Gallenleber genug Galle? Beantworten Sie diese und einige andere Fragen bei der Auswahl eines bestimmten Arzneimittels. Vielleicht wird ein Kinderarzt, der die Merkmale der Entwicklung und Gesundheit Ihres Kindes kennt, wenn er ein Medikament mit Vitamin D3 verschreibt, die Wahl selbst treffen.

Nur ein Arzt kann eine Dosierung von Medikamenten verschreiben.

Eltern erleben

In den Kommentaren der Eltern, die die Kinder Vigantol und Akvadetrim gegeben haben, gibt es auch keine einheitliche Meinung. Diese Tatsache bestätigt die Schlussfolgerungen der Kinderärzte - jedes Kind hat seine eigene Droge.

„Sohn wurde Mitte November geboren. Wir gingen für einen Monat zum Kinderarzt - wir bekamen einen Akvadetrim, um Rachitis zu verhindern. 1 Tropfen pro Tag genommen. Das Kind mochte den Geschmack von Tropfen nicht sofort (übrigens auch ich). Begann mit der Muttermilchzucht - das hat das Problem beseitigt. Die Medizin bis Mai getrunken. Rachet kam an uns vorbei, Zähne erschienen rechtzeitig, das Baby wurde in dieser Zeit nie krank. Ich bin mit der Droge zufrieden. "

Anastasia E., 43 Jahre:

„Der Sohn wurde in der 35. Schwangerschaftswoche mit einem Gewicht von 2500 kg geboren. Auch im Winter. Der Kinderarzt erklärte, dass wir automatisch gefährdet seien, und ernannte Akvadetrim (2 Tropfen pro Tag). Sehr bald erschien ein roter Ausschlag am Körper des Kindes. Zuerst verband ich es nicht mit dem Medikament und gab es dem Baby weiter. Der Ausschlag verstärkte sich. Ich musste zum Arzt gehen, der mir sagte, ich solle das Aquadreem sofort absagen. Bald löste sich die Haut. Und die "alten" Tropfen wurden durch Viganthol ersetzt, ein Medikament mit ähnlicher Wirkung, jedoch mit geringerem Allergierisiko. Diese Medizin kam zu seinem Sohn. "

„Der Arzt hat eine Tochter Vigantol verschrieben. Aber die Droge passte nicht zu uns - die Probleme mit dem Bauch begannen. Später fand ich in den Anweisungen Informationen, dass das Arzneimittel nicht für Kinder mit Magen-Darm-Problemen empfohlen wird. Und meine Tochter war auch zu früh. Der Kinderarzt ersetzte Vigantol durch Akvadetrim - diese Tropfen verursachten keine Nebenwirkungen. “

Wenn ein Kind an Magen-Darm-Erkrankungen leidet, wird Vigantol mit Vorsicht und unter Aufsicht eines Arztes verschrieben.

Zusammenfassung von

Akvadetrim und Vigantol haben eine ähnliche Wirkung, aber jede hat ihre eigenen Eigenschaften.

  • einfache Zusammensetzung, die das Risiko verringert, Allergien zu entwickeln;
  • Ölbasis, Erhöhung der Bioverfügbarkeit von Vitamin D;
  • kein scharfer Geruch und unangenehmer Geschmack;
  • Bequemlichkeit des Empfangs und der Dosierung.
  • im Vergleich zu Aquadetrim eine größere Anzahl von Kontraindikationen und Nebenwirkungen;
  • geringere Absorptionsrate;
  • kurze heilende Wirkung;
  • schlechte Resorption von Lebererkrankungen;
  • Überdosierungsrisiko aufgrund der hohen Wirkstoffkonzentration.
  • schnelle Absorption und leichte Verdaulichkeit;
  • lange therapeutische Wirkung (bis zu 3 Monate);
  • geringes Risiko einer Überdosierung.
  • scharfer Geruch und unangenehmer Geschmack;
  • hohes Allergierisiko.

Beide Medikamente sind wirksam. Die Wahl hängt von den individuellen Merkmalen des Kindes ab, die den Kinderarzt und natürlich die Eltern des Babys kennen sollten.

Keine Allergien

medizinisches Nachschlagewerk

Vigantol oder Akvadetrim, was für Babys am besten ist

Vitamin-D-Mangel im Körper des Kindes stört die Aufnahme von Kalzium und Phosphor im Darm. Dies führt häufig zu Problemen, insbesondere bei Babys. Bei Babys wachsen die Knochen sehr schnell, und ein unzureichender Mineralstoffwechsel kann sich zu einer Krankheit entwickeln, deren Folgen um das Leben kämpfen müssen.

Zur Vorbeugung von Rachitis und anderen Komplikationen, die mit einer abnormen Entwicklung des Skeletts einhergehen, werden Pädiatrie-Patienten für prophylaktische Zwecke praktisch allen Neugeborenen Medikamente mit Cholecalciferol (Vitamin D3) verschrieben - in der Regel Vigantol oder Aquadetrim.

Manchmal haben Ärzte das Recht, die Eltern zu wählen: "oder - kaufen Sie..."

Was ist die bevorzugte Medizin? Sind sie anders und wenn ja, durch was? Vigantol oder Akvadetrim - was ist das Beste für das Kind?

Auf unserer Website gibt es einige ausführliche Artikel mit Rezensionen:

Vielleicht werden sie dir nützlich sein. Wir beginnen mit einer vergleichenden Analyse von Drogen.

Was ist besser für Kinder - Vigantol oder Akvadetrim?

Ein Vergleich der Parameter von Vigantola und Akvadetrim hilft den Eltern zu entscheiden, welches dieser Medikamente für ihr Baby besser geeignet ist.

Der Wirkstoff beider Medikamente ist Cholecalciferol. Die Wirkung von Medikamenten ist daher nahezu gleich. In Viganthole ist die Vitaminkonzentration höher, was das Risiko einer Überdosierung erhöht. Seien Sie besonders vorsichtig bei der Berechnung der Dosis.

Ähnliche Formen der Freisetzung von Medikamenten - Tropfen.

Vigantol enthält keinen Alkohol, während diese Komponente in der Zusammensetzung von Aquadetrim enthalten ist, was viele Mütter beunruhigt. Eltern haben oft Angst, dem Kind Alkohol zu geben. Die Konzentration der Zutat in den Tropfen ist jedoch gering und die für Babys empfohlenen Dosierungen sind so gering, dass eine negative Auswirkung auf den Körper der Kinder ausgeschlossen wird.

Aquadime enthält Alkohol.

Es gibt auch Zitronensäure, Saccharose, Anisaroma und andere Hilfsstoffe in der Zusammensetzung von Aquadetrim. Eine vollständige Liste finden Sie in der Anleitung - Laden Sie die Gebrauchsanweisung im PDF-Format herunter.

Bei Vigantola können Sie unter den zusätzlichen Komponenten - nur Triglyceride (Fette) - Anweisungen herunterladen.

In dieser Hinsicht, Kinder anfällig für Allergien, ist es besser, Vigantol zu kaufen. Die minimale Anzahl von Komponenten verringert das Risiko einer negativen Reaktion.

Während der Einnahme von Vigantol ist es jedoch immer noch notwendig, den Zustand des Kindes zu überwachen. In den Anweisungen für das Medikament sind Nebenwirkungen, die auf Cholecalciferol allergisch sind.

Vitamin D ist das allergeneste aller Vitamine.

Akvadetrim hat aufgrund der Anwesenheit einer Anzahl synthetischer Komponenten in der Zusammensetzung einen scharfen Geruch und einen nicht sehr angenehmen Geschmack. Daher weigern sich Kinder manchmal, "duftende" Medikamente einzunehmen. Tropfen müssen in Saft oder Muttermilch aufgelöst werden.

Vigantol ist ein Medikament ohne Geschmack und Geruch und kann als wichtiger Vorteil bezeichnet werden.

Akvadetrim - eine Wasserlösung von Vitamin D3, Vigantol - Öl. Was ist die bevorzugte Option? Es wird angenommen, dass die wässrige Lösung "leichter" ist. Es wird schnell resorbiert (die Konzentration des Arzneimittels im Blut wächst etwa sechsmal schneller als bei der Einnahme eines Ölanalogons) und ist auch für Kinder mit unzureichender Gallebildung angezeigt.

Ölig - langsamer aufgenommen. Außerdem eignet es sich nicht für Babys mit einer erkrankten Leber - bei einer geringen Menge an Galle wird das Arzneimittel fast nicht aufgenommen. Öl erhöht jedoch die Bioverfügbarkeit von Vitamin D - der Verlust einer Substanz, wenn sie vom Körper verwendet wird, ist minimal.

Wässrige Lösung von Vitamin D3 wird besser aus dem Darm aufgenommen.

Die Indikationen beider Medikamente sind identisch: die Vorbeugung und Behandlung von Rachitis und Rachitis-ähnlichen Erkrankungen. Kontraindikationen stimmen meist auch überein:

  • Hypervitaminose D;
  • erhöhte Konzentration von Ca (Kalzium) im Urin;
  • erhöhter Ca-Gehalt im Blut;
  • aktive Lungentuberkulose;
  • Leber- und Nierenerkrankung;
  • Sarkoidose (eine ungewöhnliche systemische Pathologie) und einige andere.

Vigantola hat jedoch mehr Kontraindikationen. Hinzu kommen Erkrankungen des Gastrointestinaltraktes, Hypothyreose, organische Herzkrankheiten, Herzversagen.

Vigantol kann ab dem 14. Lebenstag Neugeborenen und Akvadetrim ab 4 Wochen verabreicht werden.

In Bezug auf Nebenwirkungen sind dann bei beiden Arzneimitteln üblich:

  • Allergie (das Risiko einer Allergie durch die Einnahme von Aquadetrim ist höher);
  • Verstopfung;
  • Hypervitaminose D;
  • Kopfschmerzen;
  • Beschwerden im Magen und einigen anderen.

Verstopfung ist eine Nebenwirkung der Medikation.

Spezifisch für Vigantola-Nebenwirkungen sind in der Anleitung aufgeführt - Nierenversagen, Anorexie, Arrhythmie, erhöhter Blutdruck.

Die Dauer der therapeutischen Wirkung von Medikamenten variiert. In Vigantol sind dies 1,5 Monate, in Aquadetrim 3 Monate.

Zur Prophylaxe sollten beide Medikamente einmal in 1-2 Tropfen eingenommen werden. Die therapeutische Dosis von Vigantol ist etwas niedriger als die von Akvadetrim. Dies ist auf die unterschiedliche Konzentration des Wirkstoffs in den Zubereitungen zurückzuführen (in Vigantola sind es mehr).

Wenn empfohlen wird, Akvadetrim vor dem Empfang ein wenig zu erwärmen (in den Handflächen), kann Vigantol ohne vorherige Vorbereitung verabreicht werden.

Eltern in ihren Bewertungen schreiben, dass es nicht sehr bequem ist, die richtige Menge an Akvadetrim zu messen - dies liegt an den Eigenschaften des Spenders. Vigantola Dosierdüse dachte laut Mütter besser.

Beide Medikamente gehören zu derselben Preiskategorie. Die durchschnittlichen Kosten für Flaschen mit einer Kapazität von 10 ml - 200 Rubel.

Komarovsky zufolge benötigt ein gesundes, langzeitiges Baby überhaupt keine prophylaktische Zufuhr von Vitamin D. Eine Ausnahme bilden Kinder, die in den nördlichen Gebieten mit einem kurzen hellen Tag leben. In anderen Fällen garantieren Muttermilch und tägliche Spaziergänge auf natürliche Weise eine ausreichende Produktion von Colecalciferol. Wenn die ernährungsphysiologischen Eigenschaften der Muttermilch im Zweifel sind, empfiehlt Komarovsky, auf die Anpassung der Ernährung zu achten, anstatt in der Apotheke einen „Top-Dressing“ für Säuglinge zu wählen.

Babys, die heute mit der Flasche gefüttert werden, erhalten meistens Qualitätsmischungen. Diese Produkte sind bereits (in unterschiedlichem Maße) mit Vitamin D angereichert.

Nach Ansicht von Komarovsky brauchen solche Kinder auch weder Vigantole noch Aquadetrim.

Wir sprechen hier über die Einnahme von Medikamenten zur Prophylaxe. Die allgemeine Verschreibung von Drogen zur Verhinderung von Rachitis hält Komarovsky für unangemessen. Ein Vitamin-D-Überschuss ist nicht weniger gefährlich als ein Mangel. Wenn jedoch eine Krankheit diagnostiziert wird - Rachitis, Osteomalazie, Osteopathie -, kann auf pharmazeutische Hilfe nicht verzichtet werden.

Für die Vorbeugung gegen Rachitis sind regelmäßige Spaziergänge mit einem Kind an der frischen Luft und ein Sonnenbad wichtig.

Bei der Wahl (Akvadetrim oder Vigantol) gibt Komarovsky aufgrund der Ähnlichkeit der Drogen keinen von ihnen eine ausgesprochene Präferenz. Eine gute Droge ist die richtige für Ihr Kind. Ist das Kind anfällig für Allergien? Hat er eine gastrointestinale Erkrankung? Produziert die Gallenleber genug Galle? Beantworten Sie diese und einige andere Fragen bei der Auswahl eines bestimmten Arzneimittels. Vielleicht wird ein Kinderarzt, der die Merkmale der Entwicklung und Gesundheit Ihres Kindes kennt, wenn er ein Medikament mit Vitamin D3 verschreibt, die Wahl selbst treffen.

Nur ein Arzt kann eine Dosierung von Medikamenten verschreiben.

In den Kommentaren der Eltern, die die Kinder Vigantol und Akvadetrim gegeben haben, gibt es auch keine einheitliche Meinung. Diese Tatsache bestätigt die Schlussfolgerungen der Kinderärzte - jedes Kind hat seine eigene Droge.

„Sohn wurde Mitte November geboren. Wir gingen für einen Monat zum Kinderarzt - wir bekamen einen Akvadetrim, um Rachitis zu verhindern. 1 Tropfen pro Tag genommen. Das Kind mochte den Geschmack von Tropfen nicht sofort (übrigens auch ich). Begann mit der Muttermilchzucht - das hat das Problem beseitigt. Die Medizin bis Mai getrunken. Rachet kam an uns vorbei, Zähne erschienen rechtzeitig, das Baby wurde in dieser Zeit nie krank. Ich bin mit der Droge zufrieden. "

Anastasia E., 43 Jahre:

„Der Sohn wurde in der 35. Schwangerschaftswoche mit einem Gewicht von 2500 kg geboren. Auch im Winter. Der Kinderarzt erklärte, dass wir automatisch gefährdet seien, und ernannte Akvadetrim (2 Tropfen pro Tag). Sehr bald erschien ein roter Ausschlag am Körper des Kindes. Zuerst verband ich es nicht mit dem Medikament und gab es dem Baby weiter. Der Ausschlag verstärkte sich. Ich musste zum Arzt gehen, der mir sagte, ich solle das Aquadreem sofort absagen. Bald löste sich die Haut. Und die "alten" Tropfen wurden durch Viganthol ersetzt, ein Medikament mit ähnlicher Wirkung, jedoch mit geringerem Allergierisiko. Diese Medizin kam zu seinem Sohn. "

„Der Arzt hat eine Tochter Vigantol verschrieben. Aber die Droge passte nicht zu uns - die Probleme mit dem Bauch begannen. Später fand ich in den Anweisungen Informationen, dass das Arzneimittel nicht für Kinder mit Magen-Darm-Problemen empfohlen wird. Und meine Tochter war auch zu früh. Der Kinderarzt ersetzte Vigantol durch Akvadetrim - diese Tropfen verursachten keine Nebenwirkungen. “

Wenn ein Kind an Magen-Darm-Erkrankungen leidet, wird Vigantol mit Vorsicht und unter Aufsicht eines Arztes verschrieben.

Akvadetrim und Vigantol haben eine ähnliche Wirkung, aber jede hat ihre eigenen Eigenschaften.

  • einfache Zusammensetzung, die das Risiko verringert, Allergien zu entwickeln;
  • Ölbasis, Erhöhung der Bioverfügbarkeit von Vitamin D;
  • kein scharfer Geruch und unangenehmer Geschmack;
  • Bequemlichkeit des Empfangs und der Dosierung.
  • im Vergleich zu Aquadetrim eine größere Anzahl von Kontraindikationen und Nebenwirkungen;
  • geringere Absorptionsrate;
  • kurze heilende Wirkung;
  • schlechte Resorption von Lebererkrankungen;
  • Überdosierungsrisiko aufgrund der hohen Wirkstoffkonzentration.
  • schnelle Absorption und leichte Verdaulichkeit;
  • lange therapeutische Wirkung (bis zu 3 Monate);
  • geringes Risiko einer Überdosierung.
  • scharfer Geruch und unangenehmer Geschmack;
  • hohes Allergierisiko.

Beide Medikamente sind wirksam. Die Wahl hängt von den individuellen Merkmalen des Kindes ab, die den Kinderarzt und natürlich die Eltern des Babys kennen sollten.

Kinderärzte empfehlen häufig Vitaminpräparate zur Vorbeugung von Rachitis bei Kindern. Häufiger ist es "Vigantol" und "Akvadetrim". Komarovsky argumentiert, dass es in Ermangelung von Beweisen für die Verwendung von Vitaminkomplexen im frühen Alter nicht sein sollte. Ein gesundes, in der Zeit geborenes Baby, das Muttermilch isst, benötigt keine zusätzlichen Fütterungen.

Es ist möglich, medizinische Präparate gemäß den folgenden Indikationen zu verwenden: Frühgeburt, Verletzung der Vitaminaufnahme, geringes Gewicht, Darmstörungen, Hypokalzämie. Die Verwendung von Vitaminpräparaten aus eigener Initiative ist kontraindiziert.

Beide Medikamente haben eine ähnliche Wirkung. Komarovsky ist zuversichtlich, dass Vigantol oder Akvadetrim gleichermaßen erfolgreich zur Vorbeugung und Behandlung von Rachitis eingesetzt werden können. Präparate mit Vitamin D3 sorgen für die notwendige Mineralisierung des Knochengewebes und verbessern die Calciumaufnahme. Es sollte beachtet werden, dass die Komponenten von "Vigantola" und "Akvadetrima" mit Muttermilch übertragen werden. Wenn die Mutter ein Medikament dieser Art einnimmt, sollte die Dosierung der Zusammensetzung für das Baby angepasst werden.

Komarovsky betont, dass es möglich ist, "Vigantol" und "Akvadetrim" zu verwenden, es sei jedoch darauf hingewiesen, dass die Konzentration von Vitamin D3 in "Vigantol" höher ist. "Akvadetrim" - ein auf Wasser basierendes Medikament. Es wird angenommen, dass diese Form für das Baby sicherer ist. Eine wässrige Lösung von Vitamin D3 ist leichter zu verdauen und hat für einen kleinen Patienten weniger Nebenwirkungen. Auf der anderen Seite wird Akvadetrim als allergener eingestuft als Vigantol, obwohl viel von der individuellen Reaktion des Kindes abhängt. "Vigantol" wird auf Ölbasis angeboten, was für Kinder mit individueller Intoleranz möglicherweise nicht akzeptabel ist.

Es ist möglich, die beste Behandlungsoption nur aufgrund von Erfahrungen zu wählen. Häufig werden den Kindern aufgrund ihrer hohen Absorption „Akvadetrim“ angeboten. Bei schweren rachitischen Läsionen ist Vigantol jedoch aufgrund der hohen Wirkstoffkonzentration besser geeignet.

Beide Medikamente sollten mit Vorsicht angewendet werden, da die Liste der Nebenwirkungen recht umfangreich ist. Unter ihnen:

  • Übelkeit
  • Hocker brechen
  • Gewichtsverlust
  • Verlust von Calciumsalzen bei Überdosierung.

Komarovsky betont, dass Hypervitaminose, die eine Folge der unkontrollierten Verwendung von Vitaminpräparaten ist, für ein Kind nicht weniger schlimm ist als ein Vitaminmangel. Daher kann der Gebrauch von Medikamenten ohne Beweise nicht sein.

Komarovsky bittet die Eltern, darauf zu achten, dass ein gestilltes Baby zusammen mit der Muttermilch das notwendige Kalzium sowie Elemente für seine Assimilation erhält. Wenn Sie einen niedrigen Nährwert der Muttermilch vermuten, empfiehlt Ihnen Komarovsky, über die Verbesserung der Ernährung der Mutter nachzudenken, und nicht über Möglichkeiten, die Krümel zu füttern.

Futtermischungen enthalten auch Vitamin D3, wenn auch in unterschiedlichen Konzentrationen. Bei der Entscheidung für "Vigantol" oder "Akvadetrim" sollten Eltern daher klar wissen, wie viel Vitamin ein Kind zu sich nimmt, um die Dosierung korrekt berechnen zu können.

Im Allgemeinen haben „Vigantol“ oder „Akvadetrim“ nicht so viele Unterschiede, um zu sagen, dass einer von ihnen besser und einige schlechter sind. Wählen Sie die beste Option für die Krümel auf der Grundlage des Krankheitsbildes und der individuellen Merkmale. Ihr Arzt kann die am besten geeignete Zusammensetzung auswählen und die optimale Dosierung vorschreiben.

Die meisten jungen Mütter haben früher oder später eine Frage - in welcher Form ist es besser, Ihrem Kind Vitamin D (Calciferol) zu geben? Alle Medikamente, die es enthalten, sind in zwei Gruppen unterteilt - Öl und Wasser.

Einer der berühmtesten Vertreter der ersten Gruppe war Vigantol, der zweite - Akvadetrim. Die Meinungen der Kinderärzte bezüglich dieser Drogen sind geteilt, und es gibt keine eindeutige Antwort auf die Frage "Was ist besser?". Daher müssen Eltern oft selbst Entscheidungen treffen, und dieser Artikel wird helfen.

Kurze Beschreibung von Vigantola

Die in Deutschland hergestellte Öllösung von Vitamin D ist als Vitaminpräparat der neuen Generation positioniert. Als zusätzliche Komponenten werden nur mittelkettige Triglyceride verwendet.

Dies verringert die Wahrscheinlichkeit von Komplikationen, die nicht mit der Wirkung von Vitamin D zusammenhängen, erheblich. Diese Zusammensetzung beeinflusst jedoch die Resorption des Arzneimittels und macht es unwirksam, wenn im Darm keine Galle vorhanden ist.

Vorteile von Vigantola

  • weniger wahrscheinlich allergische Reaktionen auslösen;
  • enthält keinen Alkohol;
  • es ist nicht erforderlich, vor dem gebrauch erhitzt zu werden.

Nachteile Vigantola

  • erhöhtes Risiko einer Überdosierung;
  • schlecht aufgenommen bei Kindern mit unzureichender Gallebildung.

Kaufen Sie Viganol zum Schnäppchenpreis

Wässrige Lösung von Vitamin D, hergestellt in Polen. Normalerweise ist diese Komponente nicht wasserlöslich, daher enthält Aquadetrim Benzylalkohol und eine Reihe anderer chemischer Verbindungen.

Sie helfen dabei, Vitamin D und Wasser zu mischen und bilden eine wässrige Suspension, aber eine große Anzahl von Komponenten erhöht das Risiko von Nebenwirkungen.

Auf der anderen Seite verbessert die fehlende Bindung an Fett die Resorbierbarkeit des Arzneimittels und macht es für Patienten mit eingeschränkter Synthese und Gallensekretion unverzichtbar.

Vorteile von Akvadetrim

  • leicht vom Darm aufgenommen;
  • Absorption ist nicht notwendigerweise das Vorhandensein von Galle im Darm;
  • geringeres Risiko einer Überdosierung;

Nachteile von Akvadetrima

  • vorzugsweise vor Gebrauch erhitzt;
  • enthält Alkohol;
  • hat einen bestimmten Geschmack;
  • verursacht häufiger Allergien.

Akvadetrim zum Schnäppchenpreis kaufen

Komarovsky bevorzugt keine dieser Drogen. Außerdem stellt er sogar die Frage, dass Kinder Vitamin D einnehmen müssen.

Ein zweistündiger Spaziergang im Sonnenlicht reicht aus, um den täglichen Bedarf an Calciferol zu decken, das in der Haut durch ultraviolette Strahlung synthetisiert wird.

Komarovsky über Rachitis. Der Kinderarzt behauptet, dass die Symptome von echten Rachitis bei Kindern extrem selten sind. Sie brauchen synthetisches Vitamin D nur bei bewölktem Wetter und in Regionen mit einem kurzen hellen Tag.

Bei der Wahl eines bestimmten Arzneimittels enthalten sowohl Vigantol als auch Akvaderim den gleichen Wirkstoff. Daher sollten Eltern durch die individuelle Reaktion des Kindes auf jedes dieser Arzneimittel abgestoßen werden.

Laut Reviews ist die Wirksamkeit beider Medikamente auf hohem Niveau. Bei bestimmungsgemäßer Anwendung werden die vom Hersteller angegebenen pharmakologischen Maßnahmen angegeben.

Die meisten Eltern stellten fest, dass Kinder Vigantol freiwilliger einnehmen. Dies liegt natürlich an der Tatsache, dass das Medikament auf Ölbasis ist und einen neutralen Geschmack hat. Wenn Sie Akvadetrim jedoch in Milch oder Babynahrung auflösen, wird der unangenehme Geschmack fast nicht wahrgenommen.

Bei den Nebenwirkungen ist Vigantola ein klarer Vorteil. Die Auswertung der Bewertungen ergab, dass allergische Reaktionen bei Kindern, die sie konsumierten, viel seltener auftraten als im Vergleich zu Akvadetrim. Dies liegt natürlich an der großen Anzahl chemischer Komponenten, aus denen letztere bestehen.

Die Anzahl der Nebenwirkungen, die direkt mit der Wirkung von Vitamin D verbunden sind, ist in beiden Arzneimitteln ungefähr gleich.

Wasser oder Ölbasis? Wenn Sie sich entscheiden, Ihrem Kind Vitamin D zu geben, gibt es keinen grundsätzlichen Unterschied, auf welcher Grundlage es - Wasser oder Öl - liegt. Beginnen Sie bei der Auswahl mit der Gesundheit Ihres Kindes und seiner individuellen Reaktion. Um sich zu entscheiden, müssen Sie manchmal beide Medikamente ausprobieren und vergleichen, welche davon milder auf den Körper wirkt.

Vitamine Merck KGaA. Deutschland "Vigantol" - Rezension

Akvadetrim oder Vigantol? Ich bin keine Ärztin, ich bin eine liebevolle, vernünftige Mutter. Vergleichen Sie einfach die Zusammensetzung dieser beiden Medikamente, und Sie schauen nicht mehr in Richtung der Akvadetrima +++ Vigantol-Gebrauchsanweisung und Erfahrung mit atopischer Dermatitis

Guten Tag an alle! Ich denke, dass jede junge Mutter in den ersten Wochen nach der Geburt eines Kinderarztes Empfehlungen für die Einnahme von Vitamin D "zur Vorbeugung von Rachitis bei einem Kind" hörte. Und ich bin mir ziemlich sicher, dass 99% der Mütter dringend aufgefordert wurden, Aquadetrim zu nehmen. Seltsam ist es nicht? Warum empfehlen Ärzte dieses bestimmte Medikament? Eine Art Ökumene pharmazeutisch medizinisches Komplott, nicht anders.

Auch ich erhielt eine Woche nach der Geburt beim ersten Besuch des Kinderarztes einen starken Rat, Aqua Detrum zu nehmen. Ich bin im Herbst zur Welt gekommen - und dies ist ein Mangel an Sonne usw., deshalb bin ich sofort gehorsam in die nächste Apotheke gegangen, um "Vitamine zu retten". Ich habe mir nicht die Mühe gemacht, die Zusammensetzung dieser stinkenden (schrecklichen anisischen Geruch!) Tropfen zu studieren. Ich habe nur 1 Tropfen jeden Tag in meinen Sohn gegossen. Aber in einem Monat begann mein Sohn mit der stärksten atopischen Dermatitis, und ich fing an, alle „Verdächtigen“ dieser Geißel von meiner und seiner Diät hektisch auszuschließen. Nach dem Ausschluss von Akvadetrima wurde die Haut in wenigen Tagen buchstäblich viel sauberer. Danach begannen wir mit der Einnahme von Vitamin D.

Aber bei etwa 6-7 Monaten habe ich (kein Kinderarzt) fing an, die Symptome von Rachitis bei seinem Sohn zu bemerken - er schlief nicht gut, oft weinte er, die Haare auf dem Hinterkopf waren ausgerollt, die unteren Rippen ragten leicht hervor und der Frühling war fast so groß wie unmittelbar nach der Geburt. Der Orthopäde gab nicht kategorisch an, dass das Kind Rachitis hat, aber es wurde dennoch dringend empfohlen, seinem Sohn Vitamin D in doppelter Dosis zu geben - 2-3 Tropfen. Ich erinnerte mich an Akvadetrim, gab jeden Tag 2 Tropfen - und mein Sohn hatte wieder eine akute atopische Dermatitis (ein Zufall? Ich glaube nicht).

Zum Glück las ich dann in einem der "geburtshilflichen" Instagram die Empfehlung zur Einnahme von Vitamin D, und es ging nicht um Aquadetric, sondern um Vigantol-Tropfen, die mir nicht bekannt waren. Der Arzt - der Autor dieser Instagram - argumentierte, dass Vitamin D in Form einer Öllösung besser aufgenommen wird als Wasser. In den Kommentaren des Postens schrieben viele Mütter, dass Akvadetrim bei ihren Kindern Allergien auslöste (oder, wie wir, eine Verschlimmerung der Alzheimer-Krankheit). Und der Empfang von Vigantola verursachte keine Nebenwirkungen.

Seitdem - schon fast 2 Jahre, mit Pausen für den späten Frühling und Sommer - gebe ich meinem Sohn Vigantol.

Internationaler, nicht proprietärer Name:

Dosierungsform:

Lösung für die orale Verabreichung Öl 0,5 mg / ml

Preis: 4,5 - 7 Rubel (2,2 - 3,5). Hersteller - Deutschland, die Firma Merck

Indikationen zur Verwendung. Gegenanzeigen. Anwendung während der Schwangerschaft und Stillzeit:

Indikationen zur Verwendung:

• Prävention und Behandlung von Rachitis

• Prävention von Vitamin-D-Mangel in Hochrisikogruppen (Malabsorption, chronische Erkrankungen des Dünndarms, biliäre Zirrhose, Zustände nach Gastrektomie und / oder Dünndarmresektion).

• Ipokalzämische Tetanie

• Behandlung von Osteoporose (verschiedener Genese)

• Behandlung von Osteomalazie (vor dem Hintergrund von Störungen des Mineralstoffwechsels bei Patienten über 45 Jahre, längere Immobilisierung bei Verletzungen, Einhaltung von Diäten mit Ablehnung der Einnahme von Milch und Milchprodukten)

• Behandlung von Hypoparathyreoidismus und Pseudohypoparathyreoidismus.

Gegenanzeigen

Überempfindlichkeit, Hyperkalzämie, Hyperkalzurie, Sarkoidose, Kalziumnephrourolithiasis, Thyreotoxikose (Überempfindlichkeitswahrscheinlichkeit), renale Osteodystrophie mit Hyperphosphatämie, Hypervitaminose D.

Schwangerschaft und Stillzeit

Chronische Überdosierungen (Hyperkalzämie, transplazentares Eindringen von Vitamin D3-Metaboliten in den Fötus), die sich aus einer längeren Einnahme von Vitamin D3 in Dosen ergeben, die die empfohlenen Dosen überschreiten, können zu Defekten in der körperlichen und geistigen Entwicklung des Fötus führen.

Da Vitamin D3 und seine Metaboliten während der Schwangerschaft in die Muttermilch übergehen, sollte die tägliche Dosis von D3 600 IE nicht überschreiten.

Methode der Verwendung Dosierung Symptome einer Überdosierung

Dosierung und Verabreichung

Innen Tropfen geben einen Löffel Milch oder andere Flüssigkeit ab.

• Vorbeugung gegen Rachitis: Vigantol wird ab dem zweiten Lebensmonat täglich einem Tropfen (etwa 500 ME) täglich (fünf Tage, dann eine Pause von zwei Tagen) während des ersten und des zweiten Lebensjahres, ausgenommen die Sommermonate, für Vollzeitkinder verordnet. Frühgeborenen werden ab 10 Lebenstagen (fünf Tage, dann zwei Tage Pause) pro Tag 2 Tropfen (ca. 1000 IE Vitamin D3) verordnet, ausgenommen die Sommermonate.

• Für die Behandlung von Rachitis werden ab 10 Lebenstagen 2 bis 8 Tropfen Vigantol (etwa 1000 - 5000 IE Vitamin D3) pro Tag verordnet. In den ersten zwei Lebensmonaten sowie im 5. und 9. Lebensmonat im zweiten Jahr - 1-2 Kurse im Winterfrühjahr.

• Vorbeugung gegen das Risiko von Erkrankungen, die mit Vitamin-D-Mangel verbunden sind: 1-2 Tropfen Vigantol (ca. 500 - 1000 IE Vitamin D3) pro Tag (fünf Tage einnehmen, dann zwei Tage Pause).

• Prävention von Vitamin D3-Mangel bei Malabsorptionssyndrom: 48 Tropfen Vigantol (ca. 3000 - 5000 IE Vitamin D3) pro Tag.

• Behandlung von Osteomalazie, verursacht durch einen Mangel an Vitamin DZ: 2 bis 8 Tropfen Vigantol (ca. 1000 - 5000 IE Vitamin D3) pro Tag. Die Behandlung sollte 1 Jahr fortgesetzt werden.

• Unterstützende Therapie bei Osteoporose: 2-4 Tropfen Vigantol (ca. 1000 - 3000 IE Vitamin D3) pro Tag.

• Behandlung von Hypoparathyreoidismus und Pseudohypoparathyroidismus: Abhängig von der Plasmakonzentration von Calcium werden 15-30 Tropfen Vigantol (ca. 10.000 - 20.000 IE Vitamin D3) pro Tag verordnet.

Wenn Sie eine höhere Dosis benötigen, wird empfohlen, Medikamente mit einer höheren Dosierung einzunehmen. Der Kalziumspiegel im Blut und im Urin sollte innerhalb von 4-6 Wochen, dann alle 3-6 Monate überprüft werden, und die Dosis sollte dem normalen Kalziumgehalt im Blut angepasst werden.

Nebenwirkungen

Hyperphosphatämie, Hyperkalzämie, Hyperkalzurie; Anorexie, Polyurie, Verstopfung, Kopfschmerzen, Myalgie, Arthralgie, Bluthochdruck, Arrhythmien, Nierenversagen, allergische Reaktionen.

Überdosis

Symptome einer Vitamin-D-Hypervitaminose:

früh (aufgrund von Hyperkalzämie) - Verstopfung oder Durchfall, trockene Mundschleimhaut, Kopfschmerzen, Durst, Pollakiurie, Nykturie, Polyurie, Appetitlosigkeit, metallischer Geschmack im Mund, Übelkeit, Erbrechen, extreme Müdigkeit, allgemeine Schwäche, Hyperkalzämie, Hyperkalzurie; später - Knochenschmerzen, Urin Eintrübung (Aussehen im Urin von hyaline wirft, Proteinurie, Leukozyturie), erhöhter Blutdruck, Juckreiz, Lichtempfindlichkeit des Auges, Bindehauthyperämie, Arrhythmie, Schläfrigkeit, Muskelschmerzen, Übelkeit, Erbrechen, Pankreatitis, gastralgia, Gewichtsverlust, selten - Psychose (Veränderungen in der Psyche und Stimmung).

Symptome einer chronischen Vergiftung mit Vitamin D (bei Einnahme über mehrere Wochen oder Monate bei Erwachsenen in Dosen von 20 bis 60 Tausend IE / Tag., Kinder - 2 bis 4 Tausend IE / Tag.), Verkalkung von Weichteilen, Nieren, Lungen, Blutgefäßen. Gefäße, arterieller Hypertonie, Niereninsuffizienz und chronische Herzinsuffizienz (diese Effekte treten meistens bei Hyperkalzämie, Hyperphosphatämie auf), Wachstumsstörungen bei Kindern (langfristige Verabreichung bei einer Dosis von 1,8 tausend IE / Tag).

Behandlung: Absetzen des Arzneimittels, kalziumarme Ernährung, Einnahme großer Flüssigkeitsmengen, Verabreichung von Glucocorticosteroiden, a-Tocopherol, Ascorbinsäure, Retinol, Thiamin, in schweren Fällen - intravenöse Verabreichung von 0,9% iger Natriumchloridlösung, Furosemid, Elektrolyte, Hämodialyse.

Es gibt kein spezifisches Gegenmittel.

Um in einigen Fällen eine Überdosierung auszuschließen, wird empfohlen, die Calciumkonzentration im Blut zu bestimmen (siehe "Besondere Anweisungen").

Akvadetrim oder Viganol das besser


Die meisten jungen Mütter haben früher oder später eine Frage - in welcher Form ist es besser, Ihrem Kind Vitamin D (Calciferol) zu geben? Alle Medikamente, die es enthalten, sind in zwei Gruppen unterteilt - Öl und Wasser.

Einer der berühmtesten Vertreter der ersten Gruppe war Vigantol, der zweite - Akvadetrim. Die Meinungen der Kinderärzte bezüglich dieser Drogen sind geteilt, und es gibt keine eindeutige Antwort auf die Frage "Was ist besser?". Daher müssen Eltern oft selbst Entscheidungen treffen, und dieser Artikel wird helfen.

Vitamin-D-Medikamente

Kurze Beschreibung von Vigantola

Die in Deutschland hergestellte Öllösung von Vitamin D ist als Vitaminpräparat der neuen Generation positioniert. Als zusätzliche Komponenten werden nur mittelkettige Triglyceride verwendet.

Dies verringert die Wahrscheinlichkeit von Komplikationen, die nicht mit der Wirkung von Vitamin D zusammenhängen, erheblich. Diese Zusammensetzung beeinflusst jedoch die Resorption des Arzneimittels und macht es unwirksam, wenn im Darm keine Galle vorhanden ist.

Vorteile von Vigantola

  • weniger wahrscheinlich allergische Reaktionen auslösen;
  • enthält keinen Alkohol;
  • es ist nicht erforderlich, vor dem gebrauch erhitzt zu werden.

Nachteile Vigantola

  • erhöhtes Risiko einer Überdosierung;
  • schlecht aufgenommen bei Kindern mit unzureichender Gallebildung.

Kurze Beschreibung von Aquadetrim

Wässrige Lösung von Vitamin D, hergestellt in Polen. Normalerweise ist diese Komponente nicht wasserlöslich, daher enthält Aquadetrim Benzylalkohol und eine Reihe anderer chemischer Verbindungen.

Sie helfen dabei, Vitamin D und Wasser zu mischen und bilden eine wässrige Suspension, aber eine große Anzahl von Komponenten erhöht das Risiko von Nebenwirkungen.

Auf der anderen Seite verbessert die fehlende Bindung an Fett die Resorbierbarkeit des Arzneimittels und macht es für Patienten mit eingeschränkter Synthese und Gallensekretion unverzichtbar.

Vorteile von Akvadetrim

  • leicht vom Darm aufgenommen;
  • Absorption ist nicht notwendigerweise das Vorhandensein von Galle im Darm;
  • geringeres Risiko einer Überdosierung;

Nachteile von Akvadetrima

  • vorzugsweise vor Gebrauch erhitzt;
  • enthält Alkohol;
  • hat einen bestimmten Geschmack;
  • verursacht häufiger Allergien.

Vigantol oder Akvadetrim - Komarovsky

Komarovsky bevorzugt keine dieser Drogen. Außerdem stellt er sogar die Frage, dass Kinder Vitamin D einnehmen müssen.

Ein zweistündiger Spaziergang im Sonnenlicht reicht aus, um den täglichen Bedarf an Calciferol zu decken, das in der Haut durch ultraviolette Strahlung synthetisiert wird.

Komarovsky über Rachitis. Der Kinderarzt behauptet, dass die Symptome von echten Rachitis bei Kindern extrem selten sind. Sie brauchen synthetisches Vitamin D nur bei bewölktem Wetter und in Regionen mit einem kurzen hellen Tag.

Bei der Wahl eines bestimmten Arzneimittels enthalten sowohl Vigantol als auch Akvaderim den gleichen Wirkstoff. Daher sollten Eltern durch die individuelle Reaktion des Kindes auf jedes dieser Arzneimittel abgestoßen werden.

Vigantol oder Akvadetrim Bewertungen

Laut Reviews ist die Wirksamkeit beider Medikamente auf hohem Niveau. Bei bestimmungsgemäßer Anwendung werden die vom Hersteller angegebenen pharmakologischen Maßnahmen angegeben.

Die meisten Eltern stellten fest, dass Kinder Vigantol freiwilliger einnehmen. Dies liegt natürlich an der Tatsache, dass das Medikament auf Ölbasis ist und einen neutralen Geschmack hat. Wenn Sie Akvadetrim jedoch in Milch oder Babynahrung auflösen, wird der unangenehme Geschmack fast nicht wahrgenommen.

Bei den Nebenwirkungen ist Vigantola ein klarer Vorteil. Die Auswertung der Bewertungen ergab, dass allergische Reaktionen bei Kindern, die sie konsumierten, viel seltener auftraten als im Vergleich zu Akvadetrim. Dies liegt natürlich an der großen Anzahl chemischer Komponenten, aus denen letztere bestehen.

Die Anzahl der Nebenwirkungen, die direkt mit der Wirkung von Vitamin D verbunden sind, ist in beiden Arzneimitteln ungefähr gleich.

Wasser oder Ölbasis? Wenn Sie sich entscheiden, Ihrem Kind Vitamin D zu geben, gibt es keinen grundsätzlichen Unterschied, auf welcher Grundlage es - Wasser oder Öl - liegt. Beginnen Sie bei der Auswahl mit der Gesundheit Ihres Kindes und seiner individuellen Reaktion. Um sich zu entscheiden, müssen Sie manchmal beide Medikamente ausprobieren und vergleichen, welche davon milder auf den Körper wirkt.

Akvadetrim oder Vigantol? was ist besser?

Die Urinanalyse nach Sulkovich zeigte Ca 1+. Wir bekamen einen ganzen Monat lang 4 Tropfen Vit D, tranken 1 Flasche Akvadetrim, und der Mangel stellte sich immer noch heraus. Es scheint irgendwo gelesen zu haben, dass Vigantol besser resorbiert wird. Ist es möglich, Vigthanol nach Akvadetrima einzunehmen?

Schauen Sie sich das Komarovsky-Programm über Rachitis und Vitamin D an. Dort und über die Bedeutung der Analyse von Silukovich.

Vigantol auf der Basis von Öl, in der Theorie ist es besser

Ich mochte den Akvadedrim in Geschmack und Komposition, und das Kind hatte Verstopfung

Jetzt akzeptieren wir

Und zu welchem ​​Preis Viganol?

Sie haben überhaupt nichts akzeptiert, also kann ich nicht raten, nur dass Sie in der Sonne zumindest ein kleines Gesicht beim Gehen ersetzen können.

Wir geben dir eine Liga.

Ich verstehe nicht, alle verschiedenen Urintests sind unterschiedlich, was schicken sie Ihnen oder wünschen Sie? Uns wurde gesagt, wir sollten nach 3 Monaten einen gemeinsamen Urintest bestehen, und das ist alles. Ich denke nur, dass wir vielleicht auch ein solches Problem haben, aber ich habe keinen Verdacht... oder sieht es bei Kindern so aus?

die ersten 5 monate wurden von akvadetrim gegeben, dann wechselten sie zu viganol, weil es billiger ist. Ich mag Viganol mehr, der Sohn war nach Akvadetrima zu unruhig

Wie der Kinderarzt mir erklärt hat, dass Vigantol Vitamin D ist, das auf einer Öllösung basiert, ist es für sie leicht, eine Überdosis zu verabreichen, es ist sehr schwierig, aus dem Körper entfernt zu werden, und Aquadetrim ist ein wasserlösliches Vitamin D, es ist viel sicherer und leichter aus dem Körper zu entfernen! Was mich betrifft, ist es besser zu Akvadetrim!

Versuchen Sie nun mehr in der Sonne zu laufen, stellen Sie Gesicht und Hände ein, und hier ist das ganze Vitamin D))))



Nächster Artikel
Die besten Mittel gegen Nagelpilz